PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00109608001
Common NameGSBRNA2T00109608001, LOC106397544, LOC106397553
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 339aa    MW: 37643.7 Da    PI: 7.7649
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00109608001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  GSBRNA2T00109608001 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                         79******************************99************97 PP

2Myb_DNA-binding50.16.5e-1667112148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  GSBRNA2T00109608001  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                          89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.078961IPR017930Myb domain
SuperFamilySSF466892.05E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002496.0E-161461IPR001005SANT/Myb domain
CDDcd001675.43E-111661No hitNo description
PROSITE profilePS5129423.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465117IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.3E-1467112IPR001005SANT/Myb domain
CDDcd001671.56E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKAN  120
QDSHQELDQS RDRSSLSSSP SSSSANSNSN IPRGQWERRL QTDIHLAKKA LSEALSPAVA  180
PIVTSTLATT ATTSSSSESR RSSSSTCGFL RAQETSTRYA SSTENIAKLL KGWVKTSPKT  240
QNSADQKNPP DSETKEVMRS DDVQEDCAGG FQAFSGFDNS NDCDSPYHQT KLSPDHETKQ  300
DITGCSNQSQ LSLFEKWLFE DSGGQIGDIL LDENPNFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00109608001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1553480.0AC155348.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' chromosome Cytogenetic chromosome 1 clone KBrH097M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693595.10.0PREDICTED: myb-related protein 306-like
RefseqXP_013693602.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU70.0MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A078EG970.0A0A078EG97_BRANA; BnaC09g01940D protein
STRINGBra039040.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-179myb domain protein 30
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]